PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 389aa    MW: 44666.7 Da    PI: 7.8523
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689229PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-41783PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-3181134255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                prlrWtpeLH++Fv+a+e+LGG+ekAtPk++l+lm+v gL+++hvkSHLQ+YR+
  Lsa002539  81 PRLRWTPELHHAFVNAIERLGGQEKATPKSVLHLMNVRGLSIAHVKSHLQMYRS 134
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-3077135IPR009057Homeodomain-like
PROSITE profilePS5129412.22977137IPR017930Myb domain
SuperFamilySSF466891.45E-1479135IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2481136IPR006447Myb domain, plants
PfamPF002497.5E-982133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MSGDFDTQES NEEPSFDQYG GNTSSNSSMN KQVTSFDLNE EASSQEDNID LCVEDDQKFE  60
EGSSSKNRKG RVRQYVRSKM PRLRWTPELH HAFVNAIERL GGQEKATPKS VLHLMNVRGL  120
SIAHVKSHLQ MYRSKKLDDS GQVLSQRATQ TMQGRPHIYS NLYSSRGTPF QHLKLANGGI  180
VLPSNLQEGD DHCRSHLHDS GFRPTRGIHH FLSRHQIWLS NQIQGSSPMR RDFGDGNKMM  240
KDILNHMPEK PFDANKFHGT MRSNQLLEEK KWPHDQRKDK WLPIITSSST SDPFGLSQCQ  300
QYYRERARML HSQSPFNDST PLLNSQSKAA FLLELKQDKG WKDKERKADL KLSLSQNEDV  360
DEENNHQRST PEINTMLSLS LKETETNLE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XU091e-138A0A103XU09_CYNCS; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein